No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-P |
| Brand: | Abnova |
| Reference: | PAB21614 |
| Product name: | PSMG3 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant PSMG3. |
| Isotype: | IgG |
| Gene id: | 84262 |
| Gene name: | PSMG3 |
| Gene alias: | C7orf48|MGC10911|PAC3 |
| Gene description: | proteasome (prosome, macropain) assembly chaperone 3 |
| Immunogen: | Recombinant protein corresponding to amino acids of human PSMG3. |
| Immunogen sequence/protein sequence: | VVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQ |
| Protein accession: | Q9BT73 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with PSMG3 polyclonal antibody (Cat # PAB21614). |
| Applications: | WB,IHC-P |
| Shipping condition: | Dry Ice |