ZFAND5 polyclonal antibody View larger

ZFAND5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZFAND5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ZFAND5 polyclonal antibody

Brand: Abnova
Reference: PAB21158
Product name: ZFAND5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZFAND5.
Isotype: IgG
Gene id: 7763
Gene name: ZFAND5
Gene alias: ZA20D2|ZFAND5A|ZNF216
Gene description: zinc finger, AN1-type domain 5
Immunogen: Recombinant protein corresponding to amino acids of human ZFAND5.
Immunogen sequence/protein sequence: TASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKK
Protein accession: O76080
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21158-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with ZFAND5 polyclonal antibody (Cat # PAB21158) shows strong nuclear positivity in trophoblastic cells at 1:200-1:500 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZFAND5 polyclonal antibody now

Add to cart