RWDD2B polyclonal antibody View larger

RWDD2B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RWDD2B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about RWDD2B polyclonal antibody

Brand: Abnova
Reference: PAB21032
Product name: RWDD2B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RWDD2B.
Isotype: IgG
Gene id: 10069
Gene name: RWDD2B
Gene alias: C21orf6|GL011
Gene description: RWD domain containing 2B
Immunogen: Recombinant protein corresponding to amino acids of human RWDD2B.
Immunogen sequence/protein sequence: LIRHREDIPFDGTNDETERQRKFSIFEEKVFSVNGARGNHMDFGQLYQFLNTKGCGDVFQMFFGVEGQ
Protein accession: P57060
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21032-48-43-1.jpg
Application image note: Immunohistochemical staining of human skeletal muscle with RWDD2B polyclonal antibody (Cat # PAB21032) shows strong cytoplasmic positivity in a heterogeneous staining pattern.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RWDD2B polyclonal antibody now

Add to cart