PTPRT polyclonal antibody View larger

PTPRT polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTPRT polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about PTPRT polyclonal antibody

Brand: Abnova
Reference: PAB20938
Product name: PTPRT polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PTPRT.
Isotype: IgG
Gene id: 11122
Gene name: PTPRT
Gene alias: KIAA0283|RPTPrho
Gene description: protein tyrosine phosphatase, receptor type, T
Immunogen: Recombinant protein corresponding to amino acids of human PTPRT.
Immunogen sequence/protein sequence: VHGPQNVEIVDIRARQLTLQWEPFGYAVTRCHSYNLTVQYQYVFNQQQYEAEEVIQTSSHYTLRGLRPFMTIRLRLLLSNPEGRMESEELVVQTEEDVPGAVPLESIQG
Protein accession: O14522
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20938-48-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with PTPRT polyclonal antibody (Cat # PAB20938) shows strong cytoplasmic positivity in exocrine glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy PTPRT polyclonal antibody now

Add to cart