MCU polyclonal antibody View larger

MCU polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCU polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about MCU polyclonal antibody

Brand: Abnova
Reference: PAB20874
Product name: MCU polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MCU.
Isotype: IgG
Gene id: 90550
Gene name: MCU
Gene alias: C10orf42|CCDC109A
Gene description: mitochondrial calcium uniporter
Immunogen: Recombinant protein corresponding to amino acids of human MCU.
Immunogen sequence/protein sequence: HHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLV
Protein accession: Q8NE86
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20874-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with MCU polyclonal antibody (Cat # PAB20874) shows strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MCU polyclonal antibody now

Add to cart