Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of B4GALNT2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about B4GALNT2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB20841 |
| Product name: | B4GALNT2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant B4GALNT2. |
| Isotype: | IgG |
| Gene id: | 124872 |
| Gene name: | B4GALNT2 |
| Gene alias: | B4GALGT2|B4GALT|Cad|GALGT2|MGC142235|MGC142237|SD|Sda |
| Gene description: | beta-1,4-N-acetyl-galactosaminyl transferase 2 |
| Immunogen: | Recombinant protein corresponding to amino acids of human B4GALNT2. |
| Immunogen sequence/protein sequence: | LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA |
| Protein accession: | Q8NHY0 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human prostate with B4GALNT2 polyclonal antibody (Cat # PAB20841) shows strong cytoplasmic positivity in glandular cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | B4GALNT2 (GALGT2) Gene Therapy Reduces Skeletal Muscle Pathology in the FKRP P448L Mouse Model of Limb Girdle Muscular Dystrophy 2I.Thomas PJ, Xu R, Martin PT. Am J Pathol. 2016 Sep;186(9):2429-48. |