KCNS3 polyclonal antibody View larger

KCNS3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNS3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about KCNS3 polyclonal antibody

Brand: Abnova
Reference: PAB20779
Product name: KCNS3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KCNS3.
Isotype: IgG
Gene id: 3790
Gene name: KCNS3
Gene alias: KV9.3|MGC9481
Gene description: potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3
Immunogen: Recombinant protein corresponding to amino acids of human KCNS3.
Immunogen sequence/protein sequence: KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA
Protein accession: Q9BQ31
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20779-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with KCNS3 polyclonal antibody (Cat # PAB20779) at 1-4 ug/mL dilution shows positivity in golgi apparatus, vesicles.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy KCNS3 polyclonal antibody now

Add to cart