Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB20711 |
Product name: | FDCSP polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant FDCSP. |
Isotype: | IgG |
Gene id: | 260436 |
Gene name: | FDCSP |
Gene alias: | UNQ733/PRO1419|C4orf7|FDC-SP |
Gene description: | follicular dendritic cell secreted protein |
Immunogen: | Recombinant protein corresponding to amino acids of human FDCSP. |
Immunogen sequence/protein sequence: | KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPL |
Protein accession: | Q8NFU4 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human tonsil with FDCSP polyclonal antibody (Cat # PAB20711) shows strong cytoplasmic positivity in squamous epithelial cells at 1:50-1:200 dilution. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | Localization and expression pattern of amelotin, odontogenic ameloblast-associated protein and follicular dendritic cell-secreted protein in the junctional epithelium of inflamed gingiva.Nakayama Y, Kobayashi R, Matsui S, Matsumura H, Iwai Y, Noda K, Yamazaki M, Kurita-Ochiai T, Yoshimura A, Shinomura T, Ganss B, Ogata Y. Odontology. 2016 Nov 2. [Epub ahead of print] |