KANK4 polyclonal antibody View larger

KANK4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KANK4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about KANK4 polyclonal antibody

Brand: Abnova
Reference: PAB20688
Product name: KANK4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KANK4.
Isotype: IgG
Gene id: 163782
Gene name: KANK4
Gene alias: ANKRD38|FLJ10884|KIAA0172|RP5-1155K23.5|dJ1078M7.1
Gene description: KN motif and ankyrin repeat domains 4
Immunogen: Recombinant protein corresponding to amino acids of human KANK4.
Immunogen sequence/protein sequence: IKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTDVMVNTDPVHGLLTRESCDKGIEVNLLGSMESESWGHRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQGPEQVLTSSVHSFLSTELRIEEAGTEQEGGPQGGTRGAGGFLWGS
Protein accession: Q5T7N3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20688-48-7-1.jpg
Application image note: Immunohistochemical staining of human colon with KANK4 polyclonal antibody (Cat # PAB20688) shows strong cytoplasmic positivity in glandular cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy KANK4 polyclonal antibody now

Add to cart