NHLRC3 polyclonal antibody View larger

NHLRC3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NHLRC3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about NHLRC3 polyclonal antibody

Brand: Abnova
Reference: PAB20670
Product name: NHLRC3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NHLRC3.
Isotype: IgG
Gene id: 387921
Gene name: NHLRC3
Gene alias: DKFZp313M1221|DKFZp686E1140
Gene description: NHL repeat containing 3
Immunogen: Recombinant protein corresponding to amino acids of human NHLRC3.
Immunogen sequence/protein sequence: ILWLHGENGTGPAKFNIPHSVTLDSAGRVWVADRGNKRIQVFDKDTGEWLGAWNNCFTEEGPSSVRFTPDGKYLIVAQLNLSRLSVVAAPPVGSIGECSVISTIQLADQ
Protein accession: Q5JS37
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20670-48-A1-1.jpg
Application image note: Immunohistochemical staining of human liver with NHLRC3 polyclonal antibody (Cat # PAB20670) shows strong cytoplasmic positivity with granular pattern in hepatocytes at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy NHLRC3 polyclonal antibody now

Add to cart