HSPA12B polyclonal antibody View larger

HSPA12B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPA12B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about HSPA12B polyclonal antibody

Brand: Abnova
Reference: PAB20667
Product name: HSPA12B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant HSPA12B.
Isotype: IgG
Gene id: 116835
Gene name: HSPA12B
Gene alias: C20orf60|FLJ32150|MGC131912|dJ1009E24.2
Gene description: heat shock 70kD protein 12B
Immunogen: Recombinant protein corresponding to amino acids of human HSPA12B.
Immunogen sequence/protein sequence: QLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVA
Protein accession: Q96MM6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB20667-48-6-1.jpg
Application image note: Immunohistochemical staining of human salivary gland with HSPA12B polyclonal antibody (Cat # PAB20667) shows strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy HSPA12B polyclonal antibody now

Add to cart