WBSCR17 polyclonal antibody View larger

WBSCR17 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WBSCR17 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about WBSCR17 polyclonal antibody

Brand: Abnova
Reference: PAB20665
Product name: WBSCR17 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant WBSCR17.
Isotype: IgG
Gene id: 64409
Gene name: WBSCR17
Gene alias: DKFZp434I2216|DKFZp761D2324|GALNT16|GALNT20|GALNTL3
Gene description: Williams-Beuren syndrome chromosome region 17
Immunogen: Recombinant protein corresponding to amino acids of human WBSCR17.
Immunogen sequence/protein sequence: RPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE
Protein accession: Q6IS24
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB20665-48-223-1.jpg
Application image note: Immunohistochemical staining of human hippocampus with WBSCR17 polyclonal antibody (Cat # PAB20665) shows moderate cytoplasmic positivity in neuronal cells.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy WBSCR17 polyclonal antibody now

Add to cart