LRRC70 polyclonal antibody View larger

LRRC70 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRRC70 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about LRRC70 polyclonal antibody

Brand: Abnova
Reference: PAB20656
Product name: LRRC70 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LRRC70.
Isotype: IgG
Gene id: 100130733
Gene name: LRRC70
Gene alias: SLRN
Gene description: leucine rich repeat containing 70
Immunogen: Recombinant protein corresponding to amino acids of human LRRC70.
Immunogen sequence/protein sequence: PLSSLIHLQANSNPWECNCKLLGLRDWLASSAITLNIYCQNPPSMRGRALRYINITNCVTSSINVSRAWAVVKSPHIHHKTTALMMAWHKVTTNGSPLENTETENITFWERIPTSPAGRFFQENAFGNPLETTAVLPVQIQL
Protein accession: Q7Z2Q7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20656-48-156-1.jpg
Application image note: Immunohistochemical staining of human parathyroid gland with LRRC70 polyclonal antibody (Cat # PAB20656) shows strong cytoplasmic and membranous positivity in glandular cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy LRRC70 polyclonal antibody now

Add to cart