DNAJC4 polyclonal antibody View larger

DNAJC4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAJC4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about DNAJC4 polyclonal antibody

Brand: Abnova
Reference: PAB20571
Product name: DNAJC4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DNAJC4.
Isotype: IgG
Gene id: 3338
Gene name: DNAJC4
Gene alias: DANJC4|HSPF2|MCG18|MGC19482|MGC57189|MGC71863
Gene description: DnaJ (Hsp40) homolog, subfamily C, member 4
Immunogen: Recombinant protein corresponding to amino acids of human DNAJC4.
Immunogen sequence/protein sequence: GASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQQHKQNKQ
Protein accession: Q9NNZ3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20571-48-10-1.jpg
Application image note: Immunohistochemical staining of human lymph node with DNAJC4 polyclonal antibody (Cat # PAB20571) shows strong cytoplasmic positivity in reaction center cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy DNAJC4 polyclonal antibody now

Add to cart