| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
| Brand: | Abnova |
| Reference: | PAB20530 |
| Product name: | MANEA polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant MANEA. |
| Isotype: | IgG |
| Gene id: | 79694 |
| Gene name: | MANEA |
| Gene alias: | DKFZp686D20120|ENDO|FLJ12838|hEndo |
| Gene description: | mannosidase, endo-alpha |
| Immunogen: | Recombinant protein corresponding to amino acids of human MANEA. |
| Immunogen sequence/protein sequence: | GVLALSWYPPDVNDENGEPTDNLVPTILDKAHKYNLKVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYVYDSYITKPEKWANLLTTSGSRSIRNSPYDGLFIALLVEEKHKYDILQSGFDGIYT |
| Protein accession: | Q5SRI9 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human duodenum with MANEA polyclonal antibody (Cat # PAB20530) shows distinct cytoplasmic positivity in a sub-set of inflammatory cells at 1:10-1:20 dilution. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |