Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MFF polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about MFF polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB20518 |
| Product name: | MFF polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant MFF. |
| Isotype: | IgG |
| Gene id: | 56947 |
| Gene name: | MFF |
| Gene alias: | C2orf33|DKFZp666J168|GL004|MGC110913 |
| Gene description: | mitochondrial fission factor |
| Immunogen: | Recombinant protein corresponding to amino acids of human MFF. |
| Immunogen sequence/protein sequence: | RFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKR |
| Protein accession: | Q9GZY8 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human testis with MFF polyclonal antibody (Cat # PAB20518) shows cytoplasmic and nuclear positivity in cells of seminiferus ducts at 1:50-1:200 dilution. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Mitochondrial Targeted Peptides Preserve Mitochondrial Organization and Decrease Reversible Myocardial Changes in Early Swine Metabolic Syndrome.Yuan F, Woollard JR, Jordan KL, Lerman A, Lerman LO, Eirin A. Cardiovasc Res. 2017 Dec 18. doi: 10.1093/cvr/cvx245. [Epub ahead of print] |