Cart 48 Product Products 17 664,19 € (empty)
No products
To be determined Shipping
17 664,19 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 48 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 17 664,19 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 17 664,19 €
Data sheet of B4GALT1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-P,IF |
More info about B4GALT1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB20512 |
| Product name: | B4GALT1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant B4GALT1. |
| Isotype: | IgG |
| Gene id: | 2683 |
| Gene name: | B4GALT1 |
| Gene alias: | B4GAL-T1|DKFZp686N19253|GGTB2|GT1|GTB|MGC50983|beta4Gal-T1 |
| Gene description: | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 |
| Immunogen: | Recombinant protein corresponding to amino acids of human B4GALT1. |
| Immunogen sequence/protein sequence: | LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKM |
| Protein accession: | P15291 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with B4GALT1 polyclonal antibody (Cat # PAB20512) at 1:250-1:500 dilution. |
| Applications: | WB,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | Type 2 Diabetes Biomarkers and Uses Thereof.Paramithiotis E, Prentki M, Rabasa-lhoret R, Croteau P, Lanoix J, Madiraju MSR, Joly E. United States Patent Application. 2015 Nov. 20150330997A1 |