| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
| Brand: | Abnova |
| Reference: | PAB20499 |
| Product name: | NFKBIZ polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant NFKBIZ. |
| Isotype: | IgG |
| Gene id: | 64332 |
| Gene name: | NFKBIZ |
| Gene alias: | FLJ30225|FLJ34463|IKBZ|INAP|MAIL |
| Gene description: | nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta |
| Immunogen: | Recombinant protein corresponding to amino acids of human NFKBIZ. |
| Immunogen sequence/protein sequence: | QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL |
| Protein accession: | Q9BYH8 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human spleen with NFKBIZ polyclonal antibody (Cat # PAB20499) shows strong nuclear positivity in cells of red pulp. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Dynamics of the Transcriptome during Human Spermatogenesis: Predicting the Potential Key Genes Regulating Male Gametes Generation.Zhu Z, Li C, Yang S, Tian R, Wang J, Yuan Q, Dong H, He Z, Wang S, Li Z. Sci Rep. 2016 Jan 12;6:19069. |