Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB20474 |
Product name: | CLCC1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant CLCC1. |
Isotype: | IgG |
Gene id: | 23155 |
Gene name: | CLCC1 |
Gene alias: | KIAA0761|MCLC |
Gene description: | chloride channel CLIC-like 1 |
Immunogen: | Recombinant protein corresponding to amino acids of human CLCC1. |
Immunogen sequence/protein sequence: | PPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKE |
Protein accession: | Q96S66 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western blot analysis of Lane 1: RT-4, Lane 2: Human Plasma, Lane 3: U-251 MG, Lane 4: Liver, Lane 5: Tonsil with CLCC1 polyclonal antibody (Cat # PAB20474) at 1:250-1:500 dilution. |
Applications: | WB,IHC-P,IF |
Shipping condition: | Dry Ice |