UXS1 polyclonal antibody View larger

UXS1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UXS1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about UXS1 polyclonal antibody

Brand: Abnova
Reference: PAB20451
Product name: UXS1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant UXS1.
Isotype: IgG
Gene id: 80146
Gene name: UXS1
Gene alias: FLJ23591|SDR6E1|UGD
Gene description: UDP-glucuronate decarboxylase 1
Immunogen: Recombinant protein corresponding to amino acids of human UXS1.
Immunogen sequence/protein sequence: MRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDV
Protein accession: Q8NBZ7
Form: Liquid
Recommend dilutions: Immunohistochemistry
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20451-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with UXS1 polyclonal antibody (Cat # PAB20451) shows moderate cytoplasmic positivity in neuronal cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy UXS1 polyclonal antibody now

Add to cart