No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-P |
| Brand: | Abnova |
| Reference: | PAB20310 |
| Product name: | ITGBL1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant ITGBL1. |
| Isotype: | IgG |
| Gene id: | 9358 |
| Gene name: | ITGBL1 |
| Gene alias: | OSCP|TIED |
| Gene description: | integrin, beta-like 1 (with EGF-like repeat domains) |
| Immunogen: | Recombinant protein corresponding to amino acids of human ITGBL1. |
| Immunogen sequence/protein sequence: | VCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGV |
| Protein accession: | O95965 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human pancreas with ITGBL1 polyclonal antibody (Cat # PAB20310) shows strong cytoplasmic positivity in exocrine glandular cells. |
| Applications: | WB,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | ITGBL1 Predicts a Poor Prognosis and Correlates EMT Phenotype in Gastric Cancer.Li R, Zhuang C, Jiang S, Du N, Zhao W, Tu L, Cao H, Zhang Z, Chen X. J Cancer. 2017 Oct 17;8(18):3764-3773. |