| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P,WB-Tr |
| Brand: | Abnova |
| Reference: | PAB20264 |
| Product name: | TPPP2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant TPPP2. |
| Isotype: | IgG |
| Gene id: | 122664 |
| Gene name: | TPPP2 |
| Gene alias: | C14orf8|P18|p25beta |
| Gene description: | tubulin polymerization-promoting protein family member 2 |
| Immunogen: | Recombinant protein corresponding to amino acids of human TPPP2. |
| Immunogen sequence/protein sequence: | TFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMT |
| Protein accession: | P59282 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with TPPP2 polyclonal antibody (Cat # PAB20264). |
| Applications: | IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |