No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,WB-Tr |
Brand: | Abnova |
Reference: | PAB20233 |
Product name: | C14orf119 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant C14orf119. |
Isotype: | IgG |
Gene id: | 55017 |
Gene name: | C14orf119 |
Gene alias: | FLJ20671|MGC74723 |
Gene description: | chromosome 14 open reading frame 119 |
Immunogen: | Recombinant protein corresponding to amino acids of human C14orf119. |
Immunogen sequence/protein sequence: | SLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEFSEPDFVAKFYQ |
Protein accession: | Q9NWQ9 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with C14orf119 polyclonal antibody (Cat # PAB20233). |
Applications: | IHC-P,WB-Tr |
Shipping condition: | Dry Ice |