Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DOCK8 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | IHC-P,WB-Tr |
More info about DOCK8 polyclonal antibody
| Reference: | PAB20179 |
| Product name: | DOCK8 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant DOCK8. |
| Isotype: | IgG |
| Gene id: | 81704 |
| Gene name: | DOCK8 |
| Gene alias: | FLJ00026|FLJ00152|FLJ00346|MRD2|ZIR8 |
| Gene description: | dedicator of cytokinesis 8 |
| Immunogen: | Recombinant protein corresponding to amino acids of human DOCK8. |
| Immunogen sequence/protein sequence: | AIANSLHNSKDLSKDQHGRNCLLASYVHYVFRLPEVQRDVPKSGAPTALLDPRSYHTYGRTSAAAVSSKLLQARVMSSSNPDLAGTHSAADEEVKNIMSSKIADRNCSRMSYYCSGSSDAPSS |
| Protein accession: | Q8NF50 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Shipping condition: | Dry Ice |