Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P |
Brand: | Abnova |
Reference: | PAB20095 |
Product name: | LAMB2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant LAMB2. |
Isotype: | IgG |
Gene id: | 3913 |
Gene name: | LAMB2 |
Gene alias: | LAMS |
Gene description: | laminin, beta 2 (laminin S) |
Immunogen: | Recombinant protein corresponding to amino acids of human LAMB2. |
Immunogen sequence/protein sequence: | DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG |
Protein accession: | P55268 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with LAMB2 polyclonal antibody (Cat # PAB20095). |
Applications: | WB,IHC-P |
Shipping condition: | Dry Ice |