CKAP4 polyclonal antibody View larger

CKAP4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKAP4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CKAP4 polyclonal antibody

Brand: Abnova
Reference: PAB19963
Product name: CKAP4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CKAP4.
Isotype: IgG
Gene id: 10970
Gene name: CKAP4
Gene alias: CLIMP-63|ERGIC-63|MGC99554|p63
Gene description: cytoskeleton-associated protein 4
Immunogen: Recombinant protein corresponding to amino acids 411-520 of human CKAP4.
Immunogen sequence/protein sequence: SRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQ
Protein accession: Q07065
Form: Liquid
Recommend dilutions: Immunohistochemistry
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB19963-48-37-1.jpg
Application image note: Immunohistochemical staining of human gallbladder with CKAP4 polyclonal antibody (Cat # PAB19963) shows distinct cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CKAP4 polyclonal antibody now

Add to cart