Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MSTN polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | WB-Re |
More info about MSTN polyclonal antibody
| Reference: | PAB19536 |
| Product name: | MSTN polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against full length recombinant MSTN. |
| Gene id: | 2660 |
| Gene name: | MSTN |
| Gene alias: | GDF8 |
| Gene description: | myostatin |
| Immunogen: | Recombinant protein corresponding to full length human MSTN. |
| Immunogen sequence/protein sequence: | HHHHHHDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
| Form: | Lyophilized |
| Recommend dilutions: | Western Blot (1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from PBS. |
| Storage instruction: | Store at -20°C on dry atmosphere. Aliquot to avoid repeated freezing and thawing. |
| Shipping condition: | Dry Ice |