Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDGFB polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB,ELISA,IHC |
More info about PDGFB polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB16179 |
| Product name: | PDGFB polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against PDGFB. |
| Isotype: | IgG |
| Gene id: | 5155 |
| Gene name: | PDGFB |
| Gene alias: | FLJ12858|PDGF2|SIS|SSV|c-sis |
| Gene description: | platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) |
| Immunogen: | Human PDGFB. |
| Immunogen sequence/protein sequence: | IEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTI |
| Protein accession: | P01127 |
| Form: | Lyophilized |
| Recommend dilutions: | ELISA (1-2 ug/mL) Western Blot (2-10 ug/mL) Immunohistochemistry (2-10 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from PBS |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with deionized water, store at 4°C for one month. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Applications: | WB,ELISA,IHC |
| Shipping condition: | Dry Ice |