Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDGFA polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB,ELISA,IHC |
More info about PDGFA polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB16158 |
| Product name: | PDGFA polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against PDGFA. |
| Isotype: | IgG |
| Gene id: | 5154 |
| Gene name: | PDGFA |
| Gene alias: | PDGF-A|PDGF1 |
| Gene description: | platelet-derived growth factor alpha polypeptide |
| Immunogen: | Human PDGFA. |
| Immunogen sequence/protein sequence: | VKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVR |
| Protein accession: | P04085 |
| Form: | Liquid |
| Recommend dilutions: | ELISA (1-2 ug/mL) Western Blot (2-10 ug/mL) Immunohistochemistry (2-10 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In TBS, pH 7.4 (50% glycerol, 1% BSA, 0.03% Proclin). |
| Storage instruction: | Store at 4°C for 1 month. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Applications: | WB,ELISA,IHC |
| Shipping condition: | Dry Ice |