Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Ift80 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB |
More info about Ift80 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15842 |
| Product name: | Ift80 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Ift80. |
| Isotype: | IgG |
| Gene id: | 68259 |
| Gene name: | Ift80 |
| Gene alias: | 4921524P20Rik|Wdr56|mKIAA1374 |
| Gene description: | intraflagellar transport 80 homolog (Chlamydomonas) |
| Immunogen: | Recombinant GST fusion protein corresponding to 134 amino acids of mouse Ift80. |
| Immunogen sequence/protein sequence: | KNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKK |
| Protein accession: | AK129339 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0752. This antibody detects mIFT80 protein. |
| Reactivity: | Mouse |
| Applications: | WB |
| Shipping condition: | Dry Ice |
| Publications: | IFT80 is essential for chondrocyte differentiation by regulating hedgehog and Wnt signaling pathways.Wang C, Yuan X, Yang S. Exp Cell Res. 2013 Mar 10;319(5):623-32. doi: 10.1016/j.yexcr.2012.12.028. Epub 2013 Jan 16. |