Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Fdps polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-Fr,IHC-P |
More info about Fdps polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15743 |
| Product name: | Fdps polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Fdps. |
| Gene id: | 110196 |
| Gene name: | Fdps |
| Gene alias: | 6030492I17Rik|AI256750|Fdpsl1|MGC107162|mKIAA1293 |
| Gene description: | farnesyl diphosphate synthetase |
| Immunogen: | Recombinant GST fusion protein corresponding to 116 amino acids of mouse Fdps. |
| Immunogen sequence/protein sequence: | FFQVQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLLRASPQQRQILEENYGQKDPEKVARVKALYEALDLQSAFFKYEEDSYNRLKSLIEQCSAPLPPSIFMELANKIYKRRK |
| Protein accession: | BC048497 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0577. This antibody detects mFDPS protein. It also recognizes human FDPS protein. |
| Reactivity: | Human |
| Applications: | WB,IHC-Fr,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Differential binding of proteins to peroxisomes in rat hepatoma cells: unique association of enzymes involved in isoprenoid metabolism.Gupta SD, Mehan RS, Tansey TR, Chen HT, Goping G, Goldberg I, Shechter I. J Lipid Res. 1999 Sep;40(9):1572-84. |