Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Smarcad1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IP,ChIP,ICC |
More info about Smarcad1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15737 |
| Product name: | Smarcad1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Smarcad1. |
| Gene id: | 13990 |
| Gene name: | Smarcad1 |
| Gene alias: | AV081750|AW226546|D6Pas1|Etl1|mKIAA1122 |
| Gene description: | SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 |
| Immunogen: | Recombinant GST fusion protein corresponding to 175 mouse Smarcad1. |
| Immunogen sequence/protein sequence: | DSGKFRALGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQDMTTVDEADEGSMPADIATLLKTSMGL |
| Protein accession: | AK122454 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) Immunocytochemistry (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0323. This antibody detects endogenous mSMARCAD1 protein in several cell types. It also recognizes human SMARCAD protein. |
| Reactivity: | Human |
| Applications: | WB,IP,ChIP,ICC |
| Shipping condition: | Dry Ice |
| Publications: | High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.Hara Y, Shimada K, Kohga H, Ohara O, Koga H. DNA Res. 2003 Jun 30;10(3):129-36. |