Csde1 polyclonal antibody View larger

Csde1 polyclonal antibody

New product

549,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Csde1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB

More info about Csde1 polyclonal antibody

Brand: Abnova
Reference: PAB15731
Product name: Csde1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant Csde1.
Gene id: 229663
Gene name: Csde1
Gene alias: AA960392|BC016898|D3Jfr1|MGC19174|mKIAA0885|unr
Gene description: cold shock domain containing E1, RNA binding
Immunogen: Recombinant GST fusion protein corresponding to 138 mouse Csde1.
Immunogen sequence/protein sequence: QNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGVELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPDNSMGFGAERKIRQAGVID
Protein accession: AK122393
Form: Liquid
Recommend dilutions: Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (50% glycerol, 0.02% sodium azide)
Storage instruction: Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Mouse
Specificity: Specific to recombinant protein GX0341. This antibody detects mCSDE1 protein. It also recognizes human CSDE1 protein.
Reactivity: Human
Applications: WB
Shipping condition: Dry Ice
Publications: Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H.
DNA Res. 2003 Feb 28;10(1):35-48.

Reviews

Buy Csde1 polyclonal antibody now

Add to cart