| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB-Re |
| Brand: | Abnova |
| Reference: | PAB15730 |
| Product name: | Ralgapa1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Ralgapa1. |
| Gene id: | 56784 |
| Gene name: | Garnl1 |
| Gene alias: | 2310003F20Rik|4930400K19Rik|AI563624|GRIPE|Tulip1|mKIAA0884 |
| Gene description: | GTPase activating RANGAP domain-like 1 |
| Immunogen: | Recombinant GST fusion protein corresponding to 158 mouse Ralgapa1. |
| Immunogen sequence/protein sequence: | MRPVDDPGVPSEWTSPASAGSSDLMSSDSHSDSFSAFQCEGRKFDNFGFGTDIGIPSSADVDLGSGHHQSTEEQEVASLTTLHLDSETSSLNQQAFSAEVATVTGSESASPVHSALGSRSQTPSPSTLSRAHIEQKDLQLDEKLHHSVLQTPDDLGNA |
| Protein accession: | AK129236 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0664. This antibody detects mGARNL1 protein. |
| Reactivity: | Mouse |
| Application image: | ![]() |
| Application image note: | Western blot analysis of bacterial lysate of MBP-fused antigen protein with Ralgapa1 polyclonal antibody (Cat # PAB15730). |
| Applications: | WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Prediction of the coding sequences of mouse homologues of KIAA gene: III. the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, Kikuno R, Ohara R, Inamoto S, Koseki H, Hiraoka S, Saga Y, Nagase T, Ohara O, Koga H. DNA Res. 2003 Aug 31;10(4):167-80. |