Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Morc2a polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB |
More info about Morc2a polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15729 |
| Product name: | Morc2a polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Morc2a. |
| Gene id: | 74522 |
| Gene name: | Morc2a |
| Gene alias: | 8430403M08Rik|Zcwcc1 |
| Gene description: | microrchidia 2A |
| Immunogen: | Recombinant GST fusion protein corresponding to 240 mouse Morc2a. |
| Immunogen sequence/protein sequence: | KDKGLHVEVRVNREWYTGRVTAVEVGKNAVRWKVKFDYVPTDTTPRDRWVEKGSEDVRLMKPPSPEHQSPDTQQEGGEEEEAMVARQAVALPEPSTSDGLPIEPDTTATSPSHETIDLLVQILRNCLRYFLPPSFPISKKELSVMNSEELISFPLKEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRTSEKKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIEDLITKGD |
| Protein accession: | AK173042 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX1256. This antibody detects mMORC2A protein. It also recognizes human MORC2A protein. |
| Reactivity: | Human |
| Applications: | WB |
| Shipping condition: | Dry Ice |
| Publications: | Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, F-Kikuno R, Ohara R, Inamoto S, Koseki H, Hiraoka S, Saga Y, Seino S, Nishimura M, Kaisho T, Hoshino K, Kitamura H, Nagase T, Ohara O, Koga H. DNA Res. 2004 Jun 30;11(3):205-18. |