Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB |
Brand: | Abnova |
Reference: | PAB15728 |
Product name: | Ivns1abp polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant Ivns1abp. |
Gene id: | 117198 |
Gene name: | Ivns1abp |
Gene alias: | 1190004M08Rik|1700126I16Rik|AA960440|HSPC068|ND1|NS-1|NS1-BP|Nd1-L|Nd1-S|mKIAA0850 |
Gene description: | influenza virus NS1A binding protein |
Immunogen: | Recombinant GST fusion protein corresponding to 172 mouse Ivns1abp. |
Immunogen sequence/protein sequence: | SDPYGQKGLKNCDVFDPVTKSWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGITTVGNTIYAVGGFDGNEFLNTVEVYNPQSNEWSPYTKIFQF |
Protein accession: | AK129229 |
Form: | Liquid |
Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Mouse |
Specificity: | Specific to recombinant protein GX0474. This antibody detects mIVNS1ABP protein. It also recognizes human IVNS1ABP protein. |
Reactivity: | Human |
Applications: | WB |
Shipping condition: | Dry Ice |
Publications: | Prediction of the coding sequences of mouse homologues of KIAA gene: III. the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, Kikuno R, Ohara R, Inamoto S, Koseki H, Hiraoka S, Saga Y, Nagase T, Ohara O, Koga H. DNA Res. 2003 Aug 31;10(4):167-80. |