Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB |
Brand: | Abnova |
Reference: | PAB15723 |
Product name: | Dzip3 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant Dzip3. |
Gene id: | 224170 |
Gene name: | Dzip3 |
Gene alias: | 2310047C04Rik|2A-HUB|6430549P11Rik|A230104G20 |
Gene description: | DAZ interacting protein 3, zinc finger |
Immunogen: | Recombinant GST fusion protein corresponding to 125 mouse Dzip3. |
Immunogen sequence/protein sequence: | SEPLMINWERITDRLKTAFPQQTRKELTDFLQQLKDSHGKSVSRLTFDEIVYKISQMIEPKKSESEEKSAQDGNNASPSHTASQPNAPQDPKSAQGSATWEGDKDMVRPNLLTVNTFRSERKRMV |
Protein accession: | AK122344 |
Form: | Liquid |
Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Mouse |
Specificity: | Specific to recombinant protein GX0307. This antibody detects mDZIP3 protein. It also recognizes human DZIP3 protein. |
Reactivity: | Human |
Applications: | WB |
Shipping condition: | Dry Ice |
Publications: | Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H. DNA Res. 2003 Feb 28;10(1):35-48. |