Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Kif5c polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-Fr,IHC-P |
More info about Kif5c polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15721 |
| Product name: | Kif5c polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Kif5c. |
| Gene id: | 16574 |
| Gene name: | Kif5c |
| Gene alias: | KINN|Khc|NKHC|NKHC-2|NKHC2|mKIAA0531 |
| Gene description: | kinesin family member 5C |
| Immunogen: | Recombinant GST fusion protein corresponding to 82 mouse Kif5c. |
| Immunogen sequence/protein sequence: | VKALESALKEAKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAVRGGGGGSSNSTHYQK |
| Protein accession: | AB093244 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0067. This antibody detects endogenous mKIF5C protein in several cell types. It also recognizes human KIF5C protein. |
| Reactivity: | Human |
| Applications: | WB,IHC-Fr,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.Koga H, Yuasa S, Nagase T, Shimada K, Nagano M, Imai K, Ohara R, Nakajima D, Murakami M, Kawai M, Miki F, Magae J, Inamoto S, Okazaki N, Ohara O. DNA Res. 2004 Aug 31;11(4):293-304. |