Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Zfp292 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB |
More info about Zfp292 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15720 |
| Product name: | Zfp292 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Zfp292. |
| Gene id: | 30046 |
| Gene name: | Zfp292 |
| Gene alias: | 5730450D02Rik|5830493J20Rik|9430062L07Rik|AI449016|Krox-10|Zfp-15|Zfp15|Zn-15|Zn-16|mKIAA0530 |
| Gene description: | zinc finger protein 292 |
| Immunogen: | Recombinant GST fusion protein corresponding to 136 mouse Zfp292. |
| Immunogen sequence/protein sequence: | PMGFEASFLKFLEESAVKQKKNSDRDHSNSGSKRGSHSSSRRHVDKAAVAGSSHVCSCKDSEIFVQFANPSKLQCSENVKIVLDKTLKDRSELVLKQLQEMKPTVSLKKLEVLSNNPDRTVLKEISIGKATGRGQY |
| Protein accession: | AB093243 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0006. This antibody detects mZFP292 protein. |
| Reactivity: | Mouse |
| Applications: | WB |
| Shipping condition: | Dry Ice |
| Publications: | Characterization of a mouse multigene family that encodes zinc finger structures.Chavrier P, Lemaire P, Revelant O, Bravo R, Charnay P. Mol Cell Biol. 1988 Mar;8(3):1319-26. |