Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Zscan12 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB |
More info about Zscan12 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15718 |
| Product name: | Zscan12 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Zscan12. |
| Gene id: | 22758 |
| Gene name: | Zscan12 |
| Gene alias: | 2510038J07Rik|FPM315|Zfp96|mKIAA0426 |
| Gene description: | zinc finger and SCAN domain containing 12 |
| Immunogen: | Recombinant GST fusion protein corresponding to 238 mouse Zscan12. |
| Immunogen sequence/protein sequence: | PGRKVHGCDECGKSFTQHSRLIEHKRVHTGDRPYKCEVCGKTFRWRTVLIRHKVVHTGEKPYKCNECGRAFGQWSALNQHQRLHSGEKHYHCNECGKAFCQKAGLFHHLKSHRRNRPYQCLQCNKSFNRRSTLSQHQGVHTGAKPYECNDCGKAFVYNSSLATHQETHHKEKPFTQSGPIQQQRNHTKEKPYKCSVCGKAFIQKISLIEHEQIHTGERPYKCAEGGKAFIQMSELTEH |
| Protein accession: | AK129138 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0926. This antibody detects mZSCAN12. |
| Reactivity: | Mouse |
| Applications: | WB |
| Shipping condition: | Dry Ice |
| Publications: | Prediction of the coding sequences of mouse homologues of KIAA gene: III. the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, Kikuno R, Ohara R, Inamoto S, Koseki H, Hiraoka S, Saga Y, Nagase T, Ohara O, Koga H. DNA Res. 2003 Aug 31;10(4):167-80. |