| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB |
| Brand: | Abnova |
| Reference: | PAB15715 |
| Product name: | Arhgef17 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Arhgef17. |
| Gene id: | 207212 |
| Gene name: | Arhgef17 |
| Gene alias: | 8030463K16|AI428794|AW558066|BC035332|mKIAA0337 |
| Gene description: | Rho guanine nucleotide exchange factor (GEF) 17 |
| Immunogen: | Recombinant GST fusion protein corresponding to 158 mouse Arhgef17. |
| Immunogen sequence/protein sequence: | MLAGSDAIIRQHKAACLRITALLVCAELLWVGTSAGVVLTIPTSPSTVSCPRAPLSPAGLCQGHTGHVRFLAAVQLPEGFNLLCSTPPPPPDTGPEKLPSLDHRDSPRRRGPTSARPKMLVISGGDGSEDFRLSSGGGGSSETVGRDDSTNHLLLWRV |
| Protein accession: | AK122250 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0072. This antibody detects mARHGEF17 protein. |
| Reactivity: | Mouse |
| Applications: | WB |
| Shipping condition: | Dry Ice |
| Publications: | Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H. DNA Res. 2003 Feb 28;10(1):35-48. |