Astn1 polyclonal antibody View larger

Astn1 polyclonal antibody

New product

549,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Astn1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityMouse
Host speciesRabbit
ApplicationsWB

More info about Astn1 polyclonal antibody

Brand: Abnova
Reference: PAB15713
Product name: Astn1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant Astn1.
Gene id: 11899
Gene name: Astn1
Gene alias: Astn|GC14|mKIAA0289
Gene description: astrotactin 1
Immunogen: Recombinant GST fusion protein corresponding to 103 mouse Astn1.
Immunogen sequence/protein sequence: LYHYNQHYESFGEFTWRCEDELGPRKAGLILSQLGDLSSWCNGLLQEPKISLRRGSLKYLGCRYSEIKPYGLDWSELSRDLRKTCEEQTLSVPYNDYGDSKDI
Protein accession: AB093222
Form: Liquid
Recommend dilutions: Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (50% glycerol, 0.02% sodium azide)
Storage instruction: Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Mouse
Specificity: Specific to recombinant protein GX0437. This antibody detects mASTN1 protein.
Reactivity: Mouse
Applications: WB
Shipping condition: Dry Ice
Publications: Prediction of the coding sequences of mouse homologues of KIAA gene: I. The complete nucleotide sequences of 100 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, Kikuno R, Ohara R, Inamoto S, Hara Y, Nagase T, Ohara O, Koga H.
DNA Res. 2002 Oct 31;9(5):179-88.

Reviews

Buy Astn1 polyclonal antibody now

Add to cart