Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Mouse |
Host species | Rabbit |
Applications | WB |
Brand: | Abnova |
Reference: | PAB15713 |
Product name: | Astn1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant Astn1. |
Gene id: | 11899 |
Gene name: | Astn1 |
Gene alias: | Astn|GC14|mKIAA0289 |
Gene description: | astrotactin 1 |
Immunogen: | Recombinant GST fusion protein corresponding to 103 mouse Astn1. |
Immunogen sequence/protein sequence: | LYHYNQHYESFGEFTWRCEDELGPRKAGLILSQLGDLSSWCNGLLQEPKISLRRGSLKYLGCRYSEIKPYGLDWSELSRDLRKTCEEQTLSVPYNDYGDSKDI |
Protein accession: | AB093222 |
Form: | Liquid |
Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Mouse |
Specificity: | Specific to recombinant protein GX0437. This antibody detects mASTN1 protein. |
Reactivity: | Mouse |
Applications: | WB |
Shipping condition: | Dry Ice |
Publications: | Prediction of the coding sequences of mouse homologues of KIAA gene: I. The complete nucleotide sequences of 100 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, Kikuno R, Ohara R, Inamoto S, Hara Y, Nagase T, Ohara O, Koga H. DNA Res. 2002 Oct 31;9(5):179-88. |