Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Rb1cc1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB-Re |
More info about Rb1cc1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15711 |
| Product name: | Rb1cc1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Rb1cc1. |
| Gene id: | 12421 |
| Gene name: | Rb1cc1 |
| Gene alias: | 2900055E04Rik|5930404L04Rik|Cc1|DRAGOU14|FIP200|LaXp180 |
| Gene description: | RB1-inducible coiled-coil 1 |
| Immunogen: | Recombinant GST fusion protein corresponding to 117 mouse Rb1cc1. |
| Immunogen sequence/protein sequence: | QRLMSQSLSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV |
| Protein accession: | AB093216 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0378. This antibody detects mRB1CC1 protein. |
| Reactivity: | Mouse |
| Application image: |  |
| Application image note: | Western blot analysis of Rb1cc1 polyclonal antibody (Cat # PAB15711). Bacterial lysate of MBP-fused antigen protein (Rb1cc1, partial). |
| Applications: | WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Isolation, characterization and mapping of the mouse and human RB1CC1 genes.Chano T, Ikegawa S, Saito-Ohara F, Inazawa J, Mabuchi A, Saeki Y, Okabe H. Gene. 2002 May 29;291(1-2):29-34. |