Sept8 polyclonal antibody View larger

Sept8 polyclonal antibody

New product

549,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Sept8 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-Fr,IHC-P

More info about Sept8 polyclonal antibody

Brand: Abnova
Reference: PAB15710
Product name: Sept8 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant Sept8.
Gene id: 20362
Gene name: Sept8
Gene alias: AW046166|Sepl|mKIAA0202
Gene description: septin 8
Immunogen: Recombinant GST fusion protein corresponding to 192 mouse Sept8.
Immunogen sequence/protein sequence: AVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRIHQEEKRKVEEKRRELEEETNAFNCRKAAMEALQSQALHATSQQPLRKDKDKKN
Protein accession: AB093215
Form: Liquid
Recommend dilutions: Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS (50% glycerol, 0.02% sodium azide)
Storage instruction: Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Mouse
Specificity: Specific to recombinant protein GX0010. This antibody detects endogenous mSEPT8 protein in several cell types. It also recognizes human SEPT8 protein.
Reactivity: Human
Applications: WB,IHC-Fr,IHC-P
Shipping condition: Dry Ice
Publications: High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.Hara Y, Shimada K, Kohga H, Ohara O, Koga H.
DNA Res. 2003 Jun 30;10(3):129-36.

Reviews

Buy Sept8 polyclonal antibody now

Add to cart