| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | PAB15708 |
| Product name: | Scrib polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Scrib. |
| Gene id: | 105782 |
| Gene name: | Scrib |
| Gene alias: | AI118201|CRIB|Crc|KIAA0147|SCRIB1|Scrb1|mKIAA0147|vartul |
| Gene description: | scribbled homolog (Drosophila) |
| Immunogen: | Recombinant GST fusion protein corresponding to 143 mouse Scrib. |
| Immunogen sequence/protein sequence: | ALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDFGLQTSASPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFVEELRTLEASPSPGSQEEDGEVALVLLGRPSPGAVGPEDMTLCSSRRSVRPGRRGLGPVPS |
| Protein accession: | AK122211 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0312. This antibody detects mSCRIB protein. It also recognizes human SCRIB protein. |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western blot analysis of Scrib polyclonal antibody (Cat # PAB15708). Lane 1 : Total lysate of HaloTag-fused Scrib expressed HEK293 cells (4 ug). Lane 2 : Control HEK293 cell lysate (4 ug). |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H. DNA Res. 2003 Feb 28;10(1):35-48. |