Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Mouse |
Host species | Rabbit |
Applications | WB |
Brand: | Abnova |
Reference: | PAB15707 |
Product name: | Dhx34 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant Dhx34. |
Gene id: | 71723 |
Gene name: | Dhx34 |
Gene alias: | 1200013B07Rik|1810012L18Rik|Ddx34|mKIAA0134 |
Gene description: | DEAH (Asp-Glu-Ala-His) box polypeptide 34 |
Immunogen: | Recombinant GST fusion protein corresponding to 130 mouse Dhx34. |
Immunogen sequence/protein sequence: | GPQTITTAPSLPGLFGNSTLSPHPTKGGYAVSDYLTYNCLTSDTDLYSDCLRSFWTCPHCGLHMPFTPLERIAHENTCPEAPGDDPGSEEAAPAPPQKTSALQRPYHCQVCGQDFLFTPTEVLRHRRQHV |
Protein accession: | AK129062 |
Form: | Liquid |
Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Mouse |
Specificity: | Specific to recombinant protein GX0622. This antibody detects mDHX34 protein. |
Reactivity: | Mouse |
Applications: | WB |
Shipping condition: | Dry Ice |
Publications: | Prediction of the coding sequences of mouse homologues of KIAA gene: III. the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.Okazaki N, Kikuno R, Ohara R, Inamoto S, Koseki H, Hiraoka S, Saga Y, Nagase T, Ohara O, Koga H. DNA Res. 2003 Aug 31;10(4):167-80. |