Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Fbxw11 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB,IHC |
More info about Fbxw11 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15704 |
| Product name: | Fbxw11 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Fbxw11. |
| Gene id: | 103583 |
| Gene name: | Fbxw11 |
| Gene alias: | 2310065A07Rik|AA536858|BTRC2|BTRCP2|Fbxw1b|HOS|mKIAA0696 |
| Gene description: | F-box and WD-40 domain protein 11 |
| Immunogen: | Recombinant GST fusion protein corresponding to 108 mouse Fbxw11. |
| Immunogen sequence/protein sequence: | CLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR |
| Protein accession: | AB093260 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0195. This antibody detects endogenous mFBXW11 protein in cerebellar purkinje and molecular layer cells. |
| Reactivity: | Mouse |
| Applications: | WB,IHC |
| Shipping condition: | Dry Ice |
| Publications: | Identification of a family of human F-box proteins.Cenciarelli C, Chiaur DS, Guardavaccaro D, Parks W, Vidal M, Pagano M. Curr Biol. 1999 Oct 21;9(20):1177-9. |