Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Fnbp1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | IHC |
More info about Fnbp1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15703 |
| Product name: | Fnbp1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Fnbp1. |
| Gene id: | 14269 |
| Gene name: | Fnbp1 |
| Gene alias: | 1110057E06Rik|2210010H06Rik|FBP1|Fbp17 |
| Gene description: | formin binding protein 1 |
| Immunogen: | Recombinant GST fusion protein corresponding to 144 mouse Fnbp1. |
| Immunogen sequence/protein sequence: | QRFNQEQWEYYHTHIPNIFQKIQEMEERRIVRIGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVVEAYKSGFEPPGDIEFEDYTQPMKRTVSDNSLSSSKEGKPELRFGGKSRGKLWPFIKKNKLMSLLTSPHQ |
| Protein accession: | AK122308 |
| Form: | Liquid |
| Recommend dilutions: | The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0310. This antibody detects endogenous mFNBP1 protein in cerebellar bergmann glia cells. |
| Reactivity: | Mouse |
| Applications: | IHC |
| Shipping condition: | Dry Ice |
| Publications: | High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.Hara Y, Shimada K, Kohga H, Ohara O, Koga H. DNA Res. 2003 Jun 30;10(3):129-36. |