Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Kcnd2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | IHC |
More info about Kcnd2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15702 |
| Product name: | Kcnd2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Kcnd2 (Cerebellum, Granule cell). |
| Gene id: | 16508 |
| Gene name: | Kcnd2 |
| Gene alias: | AI839615|AW555701|Kv4.2|R75121|mKIAA1044 |
| Gene description: | potassium voltage-gated channel, Shal-related family, member 2 |
| Immunogen: | Recombinant GST fusion protein corresponding to 187 mouse Kcnd2. |
| Immunogen sequence/protein sequence: | YMQSKRNGLLSNQLQSSEDEPAFISKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHRPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL |
| Protein accession: | AB093280 |
| Form: | Liquid |
| Recommend dilutions: | The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GXD01. This antibody detects endogenous mKCND2 protein in cerebellar granule cells. |
| Reactivity: | Mouse |
| Applications: | IHC |
| Shipping condition: | Dry Ice |
| Publications: | Mutations in the genes KCND2 and KCND3 encoding the ion channels Kv4.2 and Kv4.3, conducting the cardiac fast transient outward current (ITO,f), are not a frequent cause of long QT syndrome.Frank-Hansen R, Larsen LA, Andersen P, Jespersgaard C, Christiansen M. Clin Chim Acta. 2005 Jan;351(1-2):95-100. |