Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Erc2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | IHC |
More info about Erc2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15701 |
| Product name: | Erc2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant mouse Erc2. |
| Gene id: | 238988 |
| Gene name: | Erc2 |
| Gene alias: | 6430531D06|CAST|CAST1/ERC2|D14Ertd171e |
| Gene description: | ELKS/RAB6-interacting/CAST family member 2 |
| Immunogen: | Recombinant GST fusion protein corresponding to 153 mouse Erc2. |
| Immunogen sequence/protein sequence: | LMNALEKTRQELDATKARLASTQQSLAEKEAHLANLRIERRKQLEEILEMKQEALLAAISEKDANIALLELSASKKKKTQEEVMALKREKDRLVHQLKQQTQNRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQDDEEGIWA |
| Protein accession: | AK122265 |
| Form: | Liquid |
| Recommend dilutions: | The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0090. This antibody detects endogenous mERC2 protein in cerebellar purkinje cells. |
| Reactivity: | Mouse |
| Applications: | IHC |
| Shipping condition: | Dry Ice |
| Publications: | Physical and functional interaction of the active zone proteins, CAST, RIM1, and Bassoon, in neurotransmitter release.Takao-Rikitsu E, Mochida S, Inoue E, Deguchi-Tawarada M, Inoue M, Ohtsuka T, Takai Y. J Cell Biol. 2004 Jan 19;164(2):301-11. |